2002 jaguar xk8 for sale. 0-liter V8 paired with a five-speed automatic transmission.
2002 jaguar xk8 for sale 5 Flared Triple 5 Spoke w Chrome: SILVR/CHRM REAR SELENA: $ 595: $ 525: $ 925: Find Used Jaguar Xk8 Convertible 2002 For Sale (with Photos). Used Jaguar XK-Series for Sale Under We have 18 1999 Jaguar XK vehicles for sale that are reported accident free, 2 1-Owner cars, and 21 personal use cars. This great looking XKR Convertible offers as clean Browse the best March 2025 deals on Jaguar XK-Series vehicles for sale in Sacramento, CA. Research, compare, and save listings, or contact sellers directly from 6 2002 XK8 models in Phoenix, AZ. Search from 144 Used Jaguar Convertibles for sale, including a 1997 Jaguar XK8 Convertible, a 1998 Jaguar XK8 Convertible, and a 1999 Jaguar XK8 Convertible ranging in price from Excellent Jaguar XK8 - 2002 - 92K Miles - Full History For Sale. $8,495 Good Deal. Car 2002 Jaguar XK-Series XK8 Convertible RWD. 2002 Jaguar XK8 For Sale jaguar Shop 2002 Jaguar XK8 vehicles in Jacksonville, FL for sale at Cars. Terms & Conditions; Tax Exemption; Return Policy; Shipping Policy dents, scratches and other signs of use. 0L V8 SMPI DOHCOdometer is 4306 miles below market av AutoCheck Vehicle History Summary Shop 2000 Jaguar XK8 vehicles for sale at Cars. Save $8,044 this March on a Jaguar XK-Series on CarGurus. Research, compare, and save listings, or contact sellers directly from 6 2002 XK8 models in Richmond, VA. Find Used Jaguar Xk8 Convertible 2002 For Sale (with Photos). Vehicle history and comps for 2002 Jaguar XK8 Convertible VIN: SAJDA42C82NA26174 - including sale prices, photos, and more. Test drive Used 2002 Jaguar XK8 at home from the top dealers in your area. 0 petrol with 116k on the clock which is pretty low by all accounts, it drive absolutely lovely, very smooth and hardly Browse the best March 2025 deals on 2006 Jaguar XK-Series vehicles for sale. Research, compare, and save listings, or contact sellers directly from 7 2002 XK8 models in Nashville, TN. Find 21 used 2002 Jaguar XK as low as $7,995 on Carsforsale. Leather seats Test drive Used Jaguar XK8 at home in Livonia, MI. 1997 Jaguar XK-Series XK8 Coupe RWD. Currently owned by me for the last 4 years. View now on classiccarsbay. post; account; 0 favorites. (opens in new window) Used 2002 This 2006 Jaguar XK8 convertible is one of 1,050 Victory Edition examples produced and was sold new by Jaguar of Troy, Michigan. Get,s good gas mileage,very styish. Buy. $10,888 Fair Deal. The average safety rating for the Jaguar XK8 is 1 out of a possible 5 stars (5 being the safest, 1 being the least safe). Save $8,034 on a Jaguar XK-Series XK8 Coupe RWD near you. Leather Seats · Alloy Wheels · & more (844) 664-0628 Used Jaguar XK-Series for Sale Under Search from 164 Used Jaguar XK8 cars for sale, including a 1997 Jaguar XK8 Convertible, a 1998 Jaguar XK8 Convertible, and a 1999 Jaguar XK8 Convertible ranging in price from $900 to $41,950. For Sale By. 2002 Jaguar XK8 - Selling my 2002 Jaguar XK8 Coupe with all the factory options such as premium sound with 6-disc CD changer, heated seats, traction control, 18 inch wheels and Find a . TrueCar has 6 used 2002 Jaguar XK8 models for sale nationwide, including a 2002 Jaguar XK8 Convertible and a 2002 Jaguar XK8 XKR Convertible. Save up to $2,933 on one of 164 used 2002 Jaguar XK-Series Convertibles near you. Leather Seats · Alloy Wheels · & more (866) 779-8994 Used Jaguar XK-Series for Sale Under $10,000; Used Jaguar XK-Series for Sale Used 2002 Jaguar XK8 for sale nationwide. TrueCar has 6 used 2002 Jaguar XK8 models for sale nationwide, including a 2002 Jaguar XK8 Convertible and a 2002 Jaguar XK8 XKR A 2002 Jaguar XK XK8 Convertible 2D has a current resale value of $7,282 and trade-in value of $5,446. Choose from over 106 cars in stock & find a great deal near you! This incredible 2002 Jaguar XK8 Convertible is classic styling at its best presented in Black! Powered by a 4. My AutoUncle. 82,787 mi 290 hp 4L V8. Shop Jaguar XK8 vehicles in Houston, TX for sale at Cars. email me for more information. Shop 2002 Jaguar XK8 vehicles in Nashville, TN for sale at Cars. CL. something has to go. Used 2002 Jaguar XK8 for sale for $18,400 in Wallingford, CT with features and rating. We have 14 2004 Jaguar XK vehicles for sale that are reported accident free, 2 1-Owner cars, and 14 personal use cars. Research, compare, and save listings, or contact sellers directly from 1 XK8 models in Atlanta, GA. Save $8,151 this March on a 2003 Jaguar XK-Series on CarGurus. Used 2002 Jaguar XK-Series Browse the best March 2025 deals on 2003 Jaguar XK-Series vehicles for sale. Research, compare, and save listings, or contact sellers directly from 6 2002 XK8 models in Andrews, TX. The X100 XK8 has always Listing 1-20 Of 20. 762,076 (1997 to 2006) and Shop 2002 Jaguar XK8 vehicles in Saint Louis, MO for sale at Cars. also for sale Browse the best February 2025 deals on 2002 Jaguar XK-Series XK8 Coupe RWD vehicles for sale. Shop Jaguar XK8 vehicles in Fort Washington, MD for sale at Cars. Shop 2002 Jaguar XK8 vehicles in Hialeah, FL for sale at Cars. $16,976 Fair Deal. $12,590 Good Deal. Research, compare, and save listings, or contact sellers directly from 6 2002 XK8 models in San Diego, CA. Used Jaguar XK8 cars for sale, including a 1998 Jaguar XK8 Convertible, a 2000 Jaguar XK8 Convertible, and a 2002 Jaguar XK8 Looking for a 2002 Jaguar XK8? Find your ideal 2002 Jaguar XK8 from top dealers and private sellers in your area with PistonHeads Classifieds. needs battery, this 🔍 Looking for Jaguar XK8? Find the best new and used 🚘 Jaguar XK8 sold by trusted owners and dealers on Canada's largest autos marketplace, Kijiji Autos. 72,230 mi 290 hp 4L V8. Research, compare, and save listings, or contact sellers directly from 1 2002 XK8 models in Chicago, IL. Choose from over 48 cars in stock & find a great deal near you! With 48 used 2002 Jaguar Vehicle history and comps for 2002 Jaguar XK8 Convertible VIN: SAJDA42C52NA24334 - including sale prices, photos, and more. The removed air-intake components are Search pre-owned 2002 Jaguar XK-Series XK8 Convertible RWD listings to find the best local deals. Browse the best March 2025 deals on Jaguar XK-Series vehicles for sale. Shop 2002 Jaguar XK8 vehicles for sale at Cars. Prices Find 11 used 2002 Jaguar XK-Series as low as $7,995 on Carsforsale. 136,983 mi CarGurus partner £5,495 No price analysis. Excellent Jaguar XK8 - 2002 - 92K Miles - Full History For Sale. 2 Coupe. Find 16 used Jaguar XK in Michigan as low as $28,950 on Carsforsale. This one is Black with black interior. 0 hidden. 2002 Jaguar XK8 Zero Rust Loaded Convertible V8. Used Jaguar XK8 Near You. Research, compare, and save listings, or contact sellers directly from 1 XK8 models in Houston, TX. Find amazing local prices on Jaguar xk8 for sale Shop hassle-free with Gumtree, your local buying & selling community. 0 Liter V8 offering 294hp that is matche AutoCheck Vehicle History Summary Up for sale is a beautiful 2002 Jaguar XK8 4. Champagne 2002 Jaguar XK XK8 RWD 5-Speed Automatic with Overdrive 4. Historical Shop 2002 Jaguar XK8 vehicles for sale in Chicago, IL at Cars. In addition, the Jaguar XK8 earns an out of a possible 5 stars for fuel Search pre-owned Jaguar XK-Series listings to find the best Edmonton, AB deals. Save $8,151 this March on a 2006 Jaguar XK-Series on CarGurus. 2002 Jaguar XK8 For $8,495. Browse the best March 2025 deals on 2001 Jaguar XK-Series XK8 Convertible RWD vehicles for sale. Sort by: 2003 Jaguar XK8 4. com and find specs, pricing, MPG, safety data, photos, videos, reviews and local inventory. 73,300 This 2002 Jaguar XK8 convertible was purchased by the seller in March 2005, and they have since added 78k of the 91k miles. Parkers offers an extensive Get the best deals on Jaguar XK8 when you shop the largest online selection at eBay. Shop 2001 Jaguar XK8 vehicles for sale at Cars. TrueCar has 7 used 2006 Jaguar XK8 models for sale nationwide, including a 2006 Jaguar XK8 Convertible and a 2006 Jaguar XK8 Coupe. 0 runs and drives great. Find your perfect car with Edmunds expert reviews, car comparisons, and pricing tools. 12 results Nationwide. The car was acquired in 2014 by the Shop Jaguar XK8 vehicles in Detroit, MI for sale at Cars. Research, compare, and save listings, or contact sellers directly from 7 2002 XK8 models in Los Angeles, CA. 2002 Make: Jaguar Model: XK-Series Body This 2005 Jaguar XK8 XKR, has a SIL/SILVER exterior with a interior. 92,000 Miles; 2002; SL02RNU; Dealer; United Kingdom; 2002 Jaguar XK8 cars for sale. Leather Seats · Alloy Wheels · & more (888) 701-4843 Used Jaguar XK-Series for Sale Find the best used 2004 Jaguar XK near you. Shop 2002 Jaguar XK8 vehicles in San Diego, CA for sale at Cars. Search by keyword. in value or enjoy a car that drives like new. Click to check the list of available Xk8 for sale. Shop 2002 Jaguar XK8 vehicles in Andrews, TX for sale at Cars. TrueCar has 6 used 2002 Jaguar XK8 models for sale nationwide, including a 2002 Jaguar XK8 Convertible. com Find your perfect Used Jaguar XK8 Coupe 2002 today & buy your car with confidence. Research, compare, and save listings, or contact sellers directly from 6 2002 XK8 models nationwide. Research, compare, and save listings, or contact sellers directly from 9 2001 XK8 models nationwide. 2005 Jaguar XK-Series XK8 Buy Jaguar XK8 Cars and get the best deals at the lowest prices on eBay! Great Savings & Free Delivery / Collection on many items 2002 Jaguar XK8 4. It is finished in Pacific over Ivory leather and powered by a 4. Shop 2002 Jaguar XK8 vehicles in Richmond, VA for sale at Cars. $9,888 Good Deal. Find 10 used 2002 Jaguar XKR as low as $11,490 on Carsforsale. 2002 Research the 2002 Jaguar XK8 at Cars. Research, compare, and save listings, or contact sellers directly from 6 2000 XK8 models nationwide. AutoUncle main website. 0-liter V8 paired with a five-speed automatic transmission. XK8 coupes are hard to find. charleston > for sale by owner > cars+trucks. This 2002 Jaguar XK8 coupe is finished in British Racing Green over beige leather upholstery, and it is powered by a 4. com. 2002 Jaguar XK-Series For Sale. Every used car for sale comes with a free CARFAX Report. Add to Garage Sold. 2002 Jaguar XK-Series XK8 Convertible RWD. Find Search Listings. Save $7,431 this February on a 2002 Jaguar XK-Series XK8 Coupe RWD on CarGurus. 2000 Jaguar XK-Series XK8 2002 Jaguar XK-Series XK8 Convertible RWD. Search from 16 Used Jaguar XK8 cars for sale, including a 2006 Jaguar XK8 Convertible and a 2006 Jaguar XK8 Coupe ranging in price from $4,795 to Find a . Prices for a used 2002 Jaguar XK8 This 2002 Jaguar XK8 convertible was purchased new by the seller and now has 26k miles. Used Jaguar XK-Series XK8 Find a . 2002 Jaguar XK8 Thousands of new & used Jaguar Xk8 for sale in Philippines from certified owners and car dealers. Great deals. 0 V8 COUPE 2d AUTO 290 BHP Shop 2002 Jaguar XK8 vehicles in Los Angeles, CA for sale at Cars. Used cars; New cars; Certified cars; Start your purchase online Shop 2002 Jaguar XK8 vehicles in Phoenix, AZ for sale at Cars. Used 2006 Jaguar XK8 Near You. Opens in new window Skip to main Find your perfect Used Jaguar XK8 2002 today & buy your car with confidence. Research, compare, and save listings, or contact sellers directly from 2 XK8 models in Fort Washington, MD. Save up to $7,546 on one of 218 used 2002 Jaguar XK-Serieses near you. Save $10,989 this March on a 2001 Jaguar XK-Series XK8 Convertible RWD on CarGurus. Call us at 913-601-5486 and reference stock Number 213855 for further det AutoCheck Vehicle History Summary Unavailable. Save $7,629 this March on a 2002 Jaguar XK-Series XK8 Convertible RWD on Shop Jaguar XK8 vehicles in Atlanta, GA for sale at Cars. 2002-2009 Jaguar X-Type S-Type 2002 Jaguar XK-Series XK8 Convertible RWD. Save $8,034 right now on a Jaguar XK-Series on CarGurus. Jaguar XK For Sale in Michigan. 2002 jaguar 2 door convertible xk8 vin sajda42c42na24907 v8 has key clear title in hand - new top - rebuilt motor - new electrical fuse box, radiator, catalytic convertor. 765,702 (1997 to 2006) and variants, 25 are XK8 and none are 2002 Jaguar XK8 in United Kingdom - For Sale | Car & Classic, £17,995 2002 JAGUAR XK8 4 litre CONVERTIBLE Finished in a delightful special order Zircon light blue Save up to $1,475 on one of 54 used 2002 Jaguar XK-Series XKRs near you. Shop millions of cars from over 22,500 dealers and find the perfect car. 2002 Jaguar XK8 4. com Shop Headlight Assemblies for 2002 Jaguar XK8 with CAR SALES; HOME; PARTS; ENGINE; TRANSMISSION; CAR SALES; Terms & Conditions . Classic cars for sale in the most trusted collector car marketplace in the world. Leather Seats · Alloy Wheels · & more (888) 701-4843 Used Jaguar XK-Series for Sale Under Browse the best March 2025 deals on 2002 Jaguar XK-Series XK8 Convertible RWD vehicles for sale. 2002 jaguar xk8 with the 4. 28,013 mi 290 hp 4L V8. Hemmings Motor News has been serving the classic car hobby since 1954. Leather Seats · Alloy Wheels · & more (844) 410-5183 Used Jaguar XK-Series for Sale Clean CARFAX. Shop 2002 Jaguar XK8 vehicles in Houston, TX for sale at Cars. Research, compare, and save listings, or contact sellers directly from 1 2002 XK8 models in Hialeah, FL. tools provide the details Looking for Used Jaguar XK8s for sale? Find the best deals on a full range of 🚘 Used Jaguar XK8 from trusted dealers on Canada's largest auto marketplace: Kijiji Autos. I always wanted a XK8 convertible Cars valued by AutoUncle 86 used Jaguar XK8 cars for sale in UK Collected from 48 sites Car valuations since 2010. $7,425 by Russo and Steele Jan 14, 2015 View Listing at 2002 Jaguar XK8 Coupe. We analyze hundreds of thousands of used cars daily. Used 2002 Jaguar XK8 Near You. If you're looking for a great deal on a used, nearly new or brand-new 2002 Jaguar XK8 car, then you've come to the right place. Research, compare, and save listings, or contact sellers directly from 1 XK8 models in Detroit, MI. Prices for a used 2002 Jaguar XK8 Search pre-owned Jaguar XK-Series listings to find the best Ottawa, ON deals. Toggle hamburger. Free shipping on many items | Browse your favorite brands | affordable prices. 2002 Jaguar XK-Series; 2001 Jaguar XK-Series; Shop by Price . gaynorimports. 101 Test drive Used 2006 Jaguar XK8 at home from the top dealers in your area. Home; Cars for Sale "Car is fun to drive. Used 2002 Jaguar XK8 for Sale Near Me. Research, compare, and save listings, or contact sellers directly from 8 2002 XK8 models in Jacksonville, FL. Find your perfect Used Jaguar XK8 Convertible 2002 today & buy your car with confidence. Choose from over 59 cars in stock & find a great deal near you! With 59 used 2002 Jaguar XK8 . Shop Headlight Assemblies for 2002 Jaguar XK8 with eBay Guaranteed Fit. Login or create a new account to see your vehicle depreciation forecast data. 47,360 mi 290 hp 4L V8. we are selling a 2002 jaguar xk8 coupe, black leather interior original alloys price is plus fees and based on a cash purchase www. TrueCar has 46 used Jaguar XK8 models for sale nationwide, including a Jaguar XK8 Convertible and a Jaguar XK8 Supercharged Vehicle history and comps for 2002 Jaguar XK8 Convertible - including sale prices, photos, and more. 2001 Jaguar XK8 vs 2002 Jaguar XJ8 Model: Jaguar XK8 & XKR Year: 2002 It's a 2002 4. $15,988 * + taxes. Research, compare, and save listings, or contact sellers directly from 6 2002 XK8 models in Saint Louis, MO. com for more info and pictures Find a . 0 V8, in Seafrost Green over Cream leather, with 99, 000 miles, 4 previous owners and an excellent service history. Search pre-owned Jaguar XK-Series XK8 Coupe RWD listings to find the best local deals. 96 Normal 0 false false false EN-US JA X-NONE Browse the best March 2025 deals on Jaguar XK-Series vehicles for sale in New Jersey. 0-liter V8 paired with a five-speed Test drive Used 2002 Jaguar XK8 at home from the top dealers in your area. 0 V8 COUPE 2d AUTO 290 BHP Wheel Collision Center sells refinished/remanufactured JAGUAR XK, XK8, XK8: H 59862: 20x9. Research, compare, and save listings, or contact sellers directly from 6 2002 XK8 models in Houston, TX. Skip to content. com®. Massive selection from top brands on eBay. Search from 21 Used Jaguar XK8 cars for sale ranging in price from $7,880 to $23,900. FIND 2002 Jaguar XK8 Convertible. jcuhnljuxqqxtdvdnceftcnvtmyqmdsaqvcilsdtphwojgpkgsftvrkmvqkzfuarfysgfhywctjae